Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405415

Chromosome 1 Open Reading Frame 116 (c1orf116) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SARG, C26H1orf116, E030025M07, Sarg
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405415
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C1orf116 antibody: synthetic peptide directed towards the middle region of human C1orf116
Sequence SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDA SPKTSTSLGK
Predicted Reactivity Horse : 100%, Rabbit : 100%, Chicken : 92%, Dog : 92%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against C1orf116. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C1orf116
Background C1orf116 belongs to the SARG family. It is a putative androgen-specific receptor. It is highly expressed in prostate.
Molecular Weight 37kDa
Gene ID 79098
NCBI Accession NP_001077393, NM_001083924
UniProt Q9BW04
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C1orf116 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Steketee, Ziel-van der Made, van der Korput et al.: "A bioinformatics-based functional analysis shows that the specifically androgen-regulated gene SARG contains an active direct repeat androgen response element in the first intron." in: Journal of molecular endocrinology, Vol. 33, Issue 2, pp. 477-91, 2004 (PubMed).

Alternatives for antigen "Chromosome 1 Open Reading Frame 116 (c1orf116)", type "Antibodies"
Hosts (4)
Reactivities (3)
Applications (4), (3)
Epitopes (1)
Beacon