Did you know that you can buy products from over 140 different suppliers from us?

Chromosome 1 Open Reading Frame 116 (c1orf116) (Middle Region) antibody

Details for Product No. ABIN405415
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SARG, C26H1orf116, E030025M07, Sarg
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(5)
Host
Rabbit
(5), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405415
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C1orf116
Sequence SGLTLQESNTPGLRQMNFKSNTLERSGVGLSSYLSTEKDA SPKTSTSLGK
Predicted Reactivity Horse : 100 %, Rabbit : 100 %, Chicken : 90 %, Dog : 90 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against C1orf116. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C1orf116
Background C1orf116 belongs to the SARG family. It is a putative androgen-specific receptor. It is highly expressed in prostate.
Molecular Weight 37 kDa
Gene ID 79098
NCBI Accession NM_001083924, NP_001077393
UniProt Q9BW04
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 355 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Steketee, Ziel-van der Made, van der Korput et al.: "A bioinformatics-based functional analysis shows that the specifically androgen-regulated gene SARG contains an active direct repeat androgen response element in the first intron." in: Journal of molecular endocrinology, Vol. 33, Issue 2, pp. 477-91, 2004 (PubMed).

Validation Images
back to top