Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405494

Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700011I11Rik, 2610034L15Rik, AI482016, ASC1p100, AW046480, p100, RGD1561422, asc1p100, MGC63666, zgc:63666, ASCC2, ascc2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405494
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ASCC2 antibody: synthetic peptide directed towards the middle region of human ASCC2
Sequence YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTK VPREGQEEDD
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against ASCC2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ASCC2
Background ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation.
Molecular Weight 86kDa
Gene ID 84164
NCBI Accession NP_115580, NM_032204
UniProt Q9H1I8
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ASCC2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2)", type "Antibodies"
Hosts (9), (4)
Reactivities (12), (2), (2)
Applications (13), (7), (3), (2), (2), (1)
Epitopes (3), (2), (2), (1)
Beacon