Did you know that you can buy products from over 140 different suppliers from us?

Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2) (Middle Region) antibody

Details for Product No. ABIN405494
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700011I11Rik, 2610034L15Rik, AI482016, ASC1p100, AW046480, p100, RGD1561422, asc1p100, MGC63666, zgc:63666, ASCC2, ascc2
Epitope
Middle Region
(3), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(14), (2), (2)
Host
Rabbit
(9), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (6), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405494
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ASCC2
Sequence YEDEYDDTYDGNQVGANDADSDDELISRRPFTIPQVLRTK VPREGQEEDD
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against ASCC2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ASCC2
Background ASCC2 belongs to the ASCC2 family. It contains 1 CUE domain. ASCC2 enhances NF-kappa-B, SRF and AP1 transactivation.
Molecular Weight 86 kDa
Gene ID 84164
NCBI Accession NM_032204, NP_115580
UniProt Q9H1I8
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 757 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2) (Middle Region) antibody WB Suggested Anti-ASCC2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405494
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top