Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405512

Tripartite Motif Containing 72 (TRIM72) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC067209, MG53, RGD1562778, Trim72, Mg53
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405512
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIM72 antibody: synthetic peptide directed towards the middle region of human TRIM72
Sequence LEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQ FDKAVAVVAH
Predicted Reactivity Bovine : 100%, Pig : 100%, Dog : 92%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against TRIM72. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRIM72
Background TRIM72 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger and 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of TRIM72 remains unknown.
Molecular Weight 53kDa
Gene ID 493829
NCBI Accession NP_001008275, NM_001008274
UniProt Q6ZMU5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIM72 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 72 (TRIM72)", type "Antibodies"
Hosts (9), (5), (3)
Reactivities (14), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1)
Applications (13), (8), (4), (4), (2), (1)
Epitopes (3), (3), (3), (2), (2), (1), (1)
Beacon