Did you know that you can buy products from over 140 different suppliers from us?

Tripartite Motif Containing 72 (TRIM72) (Middle Region) antibody

Details for Product No. ABIN405512
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Trim72, MG53, Mg53, BC067209, RGD1562778
Epitope
Middle Region
(8), (7), (3), (3), (3), (2), (1), (1)
Reactivity
Rabbit, Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Human
(26), (3), (3), (2), (1), (1)
Host
Rabbit
(21), (5), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(25), (13), (9), (8), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405512
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TRIM72
Sequence LEELTFDPSSAHPSLVVSSSGRRVECSEQKAPPAGEDPRQ FDKAVAVVAH
Predicted Reactivity Bovine : 100 %, Pig : 100 %, Dog : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against TRIM72. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRIM72
Background TRIM72 belongs to the TRIM/RBCC family. It contains 1 B box-type zinc finger and 1 B30.2/SPRY domain and 1 RING-type zinc finger. The function of TRIM72 remains unknown.
Molecular Weight 53 kDa
Gene ID 493829
NCBI Accession NM_001008274, NP_001008275
UniProt Q6ZMU5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 477 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Martin, Han, Gordon et al.: "The sequence and analysis of duplication-rich human chromosome 16." in: Nature, Vol. 432, Issue 7020, pp. 988-94, 2004 (PubMed).

Validation Images
back to top