Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405711

KIAA0317 (KIAA0317) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KIAA0317, 1110018G07Rik, AI649076, AW610792, Kiaa0317, mKIAA0317, kiaa0317
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405711
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KIAA0317 antibody: synthetic peptide directed towards the middle region of human KIAA0317
Sequence VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILN NDMSEMELVF
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against KIAA0317. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KIAA0317
Background KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.
Molecular Weight 94kDa
Gene ID 9870
NCBI Accession NP_001034568, NM_001039479
UniProt O15033
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KIAA0317 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).

Alternatives for antigen "KIAA0317 (KIAA0317)", type "Antibodies"
Hosts (7), (1)
Reactivities (6)
Applications (8), (3), (1)
Epitopes (3), (1), (1), (1)
Beacon