KIAA0317 (KIAA0317) (Middle Region) antibody

Details for Product No. ABIN405711
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms KIAA0317, 1110018G07Rik, AI649076, AW610792, Kiaa0317, mKIAA0317, kiaa0317
Epitope
Middle Region
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
(4)
Host
Rabbit
(5), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN405711
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KIAA0317
Sequence VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILN NDMSEMELVF
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against KIAA0317. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KIAA0317
Background KIAA0317 contains 1 filamin repeat and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. The exact function of KIAA0317 remains unknown.
Molecular Weight 94 kDa
Gene ID 9870
NCBI Accession NM_001039479, NP_001034568
UniProt O15033
Research Area Proteolysis / Ubiquitin
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 823 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-KIAA0317 (KIAA0317) (Middle Region) antibody WB Suggested Anti-KIAA0317 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart
Background publications Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14...." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).

Hosts (5), (1)
Reactivities (4)
Applications (6), (2), (1)
Epitopes (2), (1)
back to top