Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405769

Ribosomal RNA Processing 1 Homolog B (S. Cerevisiae) (RRP1B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2600005C20Rik, D030064A17, Kiaa0179, mKIAA0179, RGD1305633, KIAA0179, NNP1L, Nnp1, RRP1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405769
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RRP1B antibody: synthetic peptide directed towards the middle region of human RRP1B
Sequence VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLH GVLKTPTSSP
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Rabbit : 100%, Chicken : 92%, Mouse : 92%, Rat : 92%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against RRP1B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RRP1B
Background RRP1B belongs to the RRP1 family. It may be a novel susceptibility gene for breast cancer progression and metastasis.
Molecular Weight 84kDa
Gene ID 23076
NCBI Accession NP_055871, NM_015056
UniProt Q14684
Research Area Cancer, Transcription Factors, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RRP1B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Crawford, Qian, Ziogas et al.: "Rrp1b, a new candidate susceptibility gene for breast cancer progression and metastasis." in: PLoS genetics, Vol. 3, Issue 11, pp. e214, 2007 (PubMed).

Alternatives for antigen "Ribosomal RNA Processing 1 Homolog B (S. Cerevisiae) (RRP1B)", type "Antibodies"
Hosts (5)
Reactivities (4)
Applications (5), (1)
Epitopes (3), (2), (1), (1)
Beacon