Did you know that you can buy products from over 140 different suppliers from us?

Ribosomal RNA Processing 1 Homolog B (S. Cerevisiae) (RRP1B) (Middle Region) antibody

Details for Product No. ABIN405769
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2600005C20Rik, D030064A17, Kiaa0179, mKIAA0179, RGD1305633, KIAA0179, NNP1L, Nnp1, RRP1
Epitope
Middle Region
(7), (6), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human, Chicken
(8)
Host
Rabbit
(9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(9), (6)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405769
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RRP1B
Sequence VTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQKPLH GVLKTPTSSP
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Chicken : 90 %, Mouse : 90 %, Rat : 90 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against RRP1B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RRP1B
Background RRP1B belongs to the RRP1 family. It may be a novel susceptibility gene for breast cancer progression and metastasis.
Molecular Weight 84 kDa
Gene ID 23076
NCBI Accession NM_015056, NP_055871
UniProt Q14684
Research Area Cancer, Transcription Factors, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 758 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ribosomal RNA Processing 1 Homolog B (S. Cerevisiae) (RRP1B) (Middle Region) antibody WB Suggested Anti-RRP1B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate
anti-Ribosomal RNA Processing 1 Homolog B (S. Cerevisiae) (RRP1B) (Middle Region) antibody (2) anti-Ribosomal RNA Processing 1 Homolog B (S. Cerevisiae) (RRP1B) (Middle Region) antibody (Image 2)
Product cited in: Crawford, Qian, Ziogas et al.: "Rrp1b, a new candidate susceptibility gene for breast cancer progression and metastasis." in: PLoS genetics, Vol. 3, Issue 11, pp. e214, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405769
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top