Did you know that you can buy products from over 140 different suppliers from us?

Heat Shock 70kDa Protein 4 (HSPA4) (N-Term) antibody

Details for Product No. ABIN405790
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms hs24/p52, hspa4-a, osp94, pg-2, APG-2, HS24/P52, HSPH2, RY, hsp70, hsp70RY, 70kDa, AI317151, Hsp110, Hsp70RY, mKIAA4025, Hsp70, irp94, hspa4, wu:fi30e11, zgc:55743, zgc:77413
Epitope
N-Term
(3), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(15), (4), (2), (2), (1), (1), (1), (1), (1)
Host
Rabbit
(13), (6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(18), (5), (5), (5), (3), (3), (3), (3), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405790
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human HSPA4
Sequence PACISFGPKNRSIGAAAKSQVISNAKNTVQGFKRFHGRAF SDPFVEAEKS
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against HSPA4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HSPA4
Background HSPA4(Hsp70) belongs to the heat shock protein 70 family. It was isolated as a putative Rictor interacting protein and interaction with membranes acts as a platform for its release into the extracellular environment during its recovery from stress. Hsp70 gene expression in Rheumatoid Arthitis-affected synovial tissue is followed by Hsp70 cell surface expression on fibroblast-like synovial cells growing from RA synovial tissue. Serum Hsp70 levels were increased in Systemic sclerosis patients, and associated with pulmonary fibrosis, skin sclerosis, renal vascular damage, oxidative stress, and inflammation.
Molecular Weight 94 kDa
Gene ID 3308
NCBI Accession NM_002154, NP_002145
UniProt P34932
Research Area Heat Shock Proteins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 840 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Heat Shock 70kDa Protein 4 (HSPA4) (N-Term) antibody WB Suggested Anti-HSPA4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Background publications Kim, Jiang, Du et al.: "PHAPI, CAS, and Hsp70 promote apoptosome formation by preventing Apaf-1 aggregation and enhancing nucleotide exchange on Apaf-1." in: Molecular cell, Vol. 30, Issue 2, pp. 239-47, 2008 (PubMed).

Validation Images
back to top