Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405803

Nucleolar and Spindle Associated Protein 1 (NUSAP1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ANKT, BM037, LNP, NUSAP, PRO0310p1, Q0310, SAPL, NuSAP, AI481307, AW547774, BB165529, 2610201A12Rik, YF-9, ankt, fb76a01, fi37a11, sb:cb490, wu:fb76a01, wu:fi37a11
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405803
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NUSAP1 antibody: synthetic peptide directed towards the C terminal of human NUSAP1
Sequence LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFY KKTYKQPHLQ
Predicted Reactivity Horse : 100%, Rabbit : 100%, Rat : 92%, Zebrafish : 85%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against NUSAP1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NUSAP1
Background NUSAP1 is a microtubule-associated protein with the capacity to bundle and stabilize microtubules. It may associate with chromosomes and promote the organization of mitotic spindle microtubules around them.
Molecular Weight 25kDa
Gene ID 51203
NCBI Accession NP_057443, NM_016359
UniProt Q9BXS6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NUSAP1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Raemaekers, Ribbeck, Beaudouin et al.: "NuSAP, a novel microtubule-associated protein involved in mitotic spindle organization." in: The Journal of cell biology, Vol. 162, Issue 6, pp. 1017-29, 2003 (PubMed).

Alternatives for antigen "Nucleolar and Spindle Associated Protein 1 (NUSAP1)", type "Antibodies"
Hosts (32), (2)
Reactivities (32), (13), (11), (11), (11)
Applications (25), (15), (9), (5), (4), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (4), (1), (1), (1)
Beacon