Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405877

DKFZP564J0863 (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405877
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DKFZP564J0863 antibody: synthetic peptide directed towards the middle region of human DKFZP564J0863
Sequence DHFKKTKKMGGKDFSFRYQQELEEEIKELYENFCKHNGSK NVFSTFRTPA
Predicted Reactivity Rat :100%,   Human :100%,   Mouse :100%,   Crab-eating macaque :100%,   Bovine :92%,   Streptococcus pneumoniae BS458 :83%,   Streptococcus pneumoniae BS457 :83%,   Streptococcus pneumoniae BS397 :83%,   Streptococcus pneumoniae SP14-BS292 :83%,   Streptococcus pneumoniae SP-BS293 :83%,   Streptococcus pneumoniae BS455 :83%,   Streptococcus mitis SK564 :83%,   Streptococcus mitis SK597 :83%,   Streptococcus mitis NCTC 12261 :83%,   Streptococcus pneumoniae :83%,   Streptococcus pneumoniae MLV-016 :83%,   Streptococcus pneumoniae CDC3059-06 :83%,   Streptococcus pneumoniae SP3-BS71 :83%,   Streptococcus pneumoniae SP6-BS73 :83%,   Streptococcus pneumoniae SP9-BS68 :83%,   Streptococcus pneumoniae SP11-BS70 :83%,   Streptococcus pneumoniae SP14-BS69 :83%,   Streptococcus pneumoniae SP18-BS74 :83%,   Streptococcus pneumoniae SP19-BS75 :83%,   Streptococcus pneumoniae SP23-BS72 :83%,   Streptococcus pneumoniae CDC1873-00 :83%,   Streptococcus pneumoniae SP195 :83%,   Streptococcus pneumoniae CDC0288-04 :83%,  
Characteristics This is a rabbit polyclonal antibody against DKFZP564J0863. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background DKFZP564J0863(ATL3, atlastin GTPase 3) belongs to the GBP family.In the family of human GTPases, atlastin-2 and -3 are closely related to atlastin-1.
Molecular Weight 60kDa
Gene ID 25923
NCBI Accession NP_056274, NM_015459
UniProt Q6DD88
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DKFZP564J0863 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Dias Neto, Correa, Verjovski-Almeida et al.: "Shotgun sequencing of the human transcriptome with ORF expressed sequence tags." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 97, Issue 7, pp. 3491-6, 2000 (PubMed).

Alternatives for antigen "DKFZP564J0863", type "Antibodies"
Hosts (1)
Reactivities (1), (1), (1), (1)
Applications (1)
Epitopes (1)
Beacon