Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405971

Pyruvate Dehydrogenase beta (PDHB) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C81408, AL024199, 2610103L06Rik, CG 11876, Dmel\\CG11876, E1beta, PDHB, zgc:64062, wu:fc76a05, PDHBD, PDHE1-B, PHE1B
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405971
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PDHB antibody: synthetic peptide directed towards the N terminal of human PDHB
Sequence GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFM TFNFSMQAID
Predicted Reactivity Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Zebrafish : 92%, African clawed frog : 78%, Yeast : 78%
Characteristics This is a rabbit polyclonal antibody against PDHB. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PDHB
Background The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Molecular Weight 39kDa
Gene ID 5162
NCBI Accession NP_000916, NM_000925
UniProt P11177
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PDHB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Okajima, Korotchkina, Prasad et al.: "Mutations of the E1beta subunit gene (PDHB) in four families with pyruvate dehydrogenase deficiency." in: Molecular genetics and metabolism, Vol. 93, Issue 4, pp. 371-80, 2008 (PubMed).

Alternatives for antigen "Pyruvate Dehydrogenase beta (PDHB)", type "Antibodies"
Hosts (19), (6)
Reactivities (24), (16), (15), (12), (12)
Applications (14), (10), (10), (6), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (1), (1)
Beacon