Pyruvate Dehydrogenase beta (PDHB) (N-Term) antibody

Details for Product No. ABIN405971
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms C81408, AL024199, 2610103L06Rik, CG 11876, Dmel\\CG11876, E1beta, PDHB, zgc:64062, wu:fc76a05, PDHBD, PDHE1-B, PHE1B
Epitope
N-Term
(4), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human
(27), (18), (17), (12), (12)
Host
Rabbit
(23), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (12), (10), (9), (4), (4), (3), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN405971
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PDHB
Sequence GLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFM TFNFSMQAID
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Zebrafish : 90 %, African clawed frog : 70 %, Yeast : 70 %
Characteristics This is a rabbit polyclonal antibody against PDHB. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PDHB
Background The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2. It contains multiple copies of three enzymatic components: pyruvate dehydrogenase (E1), dihydrolipoamide acetyltransferase (E2) and lipoamide dehydrogenase (E3).
Molecular Weight 39 kDa
Gene ID 5162
NCBI Accession NM_000925, NP_000916
UniProt P11177
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 359 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Okajima, Korotchkina, Prasad et al.: "Mutations of the E1beta subunit gene (PDHB) in four families with pyruvate dehydrogenase deficiency." in: Molecular genetics and metabolism, Vol. 93, Issue 4, pp. 371-80, 2008 (PubMed).

Hosts (23), (7)
Reactivities (27), (18), (17), (12), (12)
Applications (19), (12), (10), (9), (4), (4), (3), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (1), (1), (1), (1)
back to top