Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406033

Methyltransferase 5 Domain Containing 1 (METT5D1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms METT5D1, 0610027B03Rik, AI303697, AW049952, Mett5d1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN406033
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-METT5D1 antibody: synthetic peptide directed towards the n terminal of human METT5D1
Sequence MLRYPYFCRMYKECLSCWLESGIPNLGVWPNRIHTTAEKY REYEAREQTD
Predicted Reactivity Crab-eating macaque :92%,   Sumatran orangutan :92%,   Human :100%,  
Characteristics This is a rabbit polyclonal antibody against METT5D1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name METT5D1
Background METT5D1 belongs to the methyltransferase superfamily, mraW family. METT5D1 is a probable S-adenosyl-L-methionine-dependent methyltransferase.
Molecular Weight 45kDa
Gene ID 196074
NCBI Accession NP_001107000, NM_001113528
UniProt A6NJ78
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-METT5D1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Methyltransferase 5 Domain Containing 1 (METT5D1)", type "Antibodies"
Hosts (2), (2)
Reactivities (3)
Applications (4), (2), (1)
Epitopes (2), (1)
Beacon