Did you know that you can buy products from over 140 different suppliers from us?

PHD Finger Protein 19 (PHF19) (C-Term) antibody

Details for Product No. ABIN406115
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms si:dkeyp-51b7.1, pcl3, MGC147603, MTF2L1, PCL3, TDRD19B, 3110009G19Rik, 3321402G02Rik
Epitope
C-Term
(9), (7), (1), (1), (1), (1)
Reactivity
Human
(20), (2)
Host
Rabbit
(19), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (10), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406115
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PHF19
Sequence RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSK QKGHTWALET
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against PHF19. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PHF19
Background PHF19 contains 2 PHD-type zinc fingers. It acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.
Molecular Weight 22 kDa
Gene ID 26147
NCBI Accession NM_001009936, NP_001009936
UniProt Q5T6S3-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Chromatin Binding Proteins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 207 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PHD Finger Protein 19 (PHF19) (C-Term) antibody WB Suggested Anti-PHF19 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Validation Images
back to top