PHD Finger Protein 19 (PHF19) (C-Term) antibody

Details for Product No. ABIN406115
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms MTF2L1, PCL3, TDRD19B, 3110009G19Rik, 3321402G02Rik, si:dkeyp-51b7.1, pcl3, MGC147603
Epitope
C-Term
(3), (1), (1)
Reactivity
Human
(12), (2)
Host
Rabbit
(11), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (4), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN406115
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PHF19
Sequence RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSK QKGHTWALET
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against PHF19. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PHF19
Background PHF19 contains 2 PHD-type zinc fingers. It acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.
Molecular Weight 22 kDa
Gene ID 26147
NCBI Accession NM_001009936, NP_001009936
UniProt Q5T6S3-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Chromatin Binding Proteins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 207 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PHD Finger Protein 19 (PHF19) (C-Term) antibody WB Suggested Anti-PHF19 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Hosts (11), (1)
Reactivities (12), (2)
Applications (11), (4), (3), (2), (1)
Epitopes (3), (1), (1)
back to top