Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406115

PHD Finger Protein 19 (PHF19) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MTF2L1, PCL3, TDRD19B, 3110009G19Rik, 3321402G02Rik, si:dkeyp-51b7.1, pcl3, MGC147603
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406115
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PHF19 antibody: synthetic peptide directed towards the C terminal of human PHF19
Sequence RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSK QKGHTWALET
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against PHF19. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PHF19
Background PHF19 contains 2 PHD-type zinc fingers. It acts as a transcritpional repressor. Isoform 1 and isoform 2 inhibit transcription from an HSV-tk promoter.
Molecular Weight 22kDa
Gene ID 26147
NCBI Accession NP_001009936, NM_001009936
UniProt Q5T6S3-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PHF19 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Alternatives for antigen "PHD Finger Protein 19 (PHF19)", type "Antibodies"
Hosts (12), (1)
Reactivities (13), (2)
Applications (12), (5), (3), (2), (1)
Epitopes (6), (2), (1), (1)
Beacon