Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406153

Proline Rich 11 (PRR11) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms B930067F20Rik, RGD1561541
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406153
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRR11 antibody: synthetic peptide directed towards the middle region of human PRR11
Sequence PGKSQMDLRKLLRKVDVERSPGGTPLTNKENMETGTGLTP VMTQALRRKF
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Rabbit : 100%, Mouse : 92%, Rat : 92%, Chicken : 85%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against PRR11. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PRR11
Background The function of the PRR11 protein remains unknown.
Molecular Weight 40kDa
Gene ID 55771
NCBI Accession NP_060774, NM_018304
UniProt Q96HE9
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRR11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Szafranski, Schindler, Taudien et al.: "Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns." in: Genome biology, Vol. 8, Issue 8, pp. R154, 2008 (PubMed).

Alternatives for antigen "Proline Rich 11 (PRR11)", type "Antibodies"
Hosts (15), (2)
Reactivities (16), (12), (12), (12), (12)
Applications (10), (8), (4), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1), (1)
Beacon