Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406207

GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ATG8, ATG8C, GATE-16, GATE16, GEF-2, GEF2, Gef2, 0610012F20Rik, 2900019O08Rik, AI173605, zgc:92319, atg8, gate-16, gate16, gef2, GABARAPL2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406207
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GABARAPL2 antibody: synthetic peptide directed towards the N terminal of human GABARAPL2
Sequence KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQI VDIDKRKYLV
Predicted Reactivity African clawed frog : 100%, Chicken : 100%, Dog : 100%, Human : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against GABARAPL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GABARAPL2
Background GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.
Molecular Weight 14kDa
Gene ID 11345
NCBI Accession NP_009216, NM_007285
UniProt P60520
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GABARAPL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Sou, Tanida, Komatsu et al.: "Phosphatidylserine in addition to phosphatidylethanolamine is an in vitro target of the mammalian Atg8 modifiers, LC3, GABARAP, and GATE-16." in: The Journal of biological chemistry, Vol. 281, Issue 6, pp. 3017-24, 2006 (PubMed).

Alternatives for antigen "GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2)", type "Antibodies"
Hosts (39), (4), (3), (1)
Reactivities (45), (21), (19), (13), (12)
Applications (38), (16), (16), (10), (7), (3), (3), (3), (1)
Conjugates (3), (3), (3), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (2), (2), (1), (1)
Beacon