Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406251

WD Repeat Domain 66 (WDR66) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4930415N18Rik, 4933428F06Rik, 5031404N07, RGD1564948, DKFZp469N2128
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406251
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-WDR66 antibody: synthetic peptide directed towards the N terminal of human WDR66
Sequence GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQS KAGISRESLV
Predicted Reactivity Dog : 100%, Human : 100%, Pig : 84%
Characteristics This is a rabbit polyclonal antibody against WDR66. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name WDR66
Background WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.
Molecular Weight 130kDa
Gene ID 144406
NCBI Accession NP_653269, NM_144668
UniProt Q8TBY9
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-WDR66 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "WD Repeat Domain 66 (WDR66)", type "Antibodies"
Hosts (3), (2)
Reactivities (4)
Applications (5), (3), (1), (1), (1), (1)
Epitopes (1), (1), (1)
Beacon