Did you know that you can buy products from over 140 different suppliers from us?

WD Repeat Domain 66 (WDR66) (N-Term) antibody

Details for Product No. ABIN406251
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4930415N18Rik, 4933428F06Rik, 5031404N07, RGD1564948, DKFZp469N2128
Epitope
N-Term
(2), (1), (1)
Reactivity
Dog (Canine), Human
(5)
Host
Rabbit
(4), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406251
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human WDR66
Sequence GELEEKTDRMPQDELGQERRDLEPENREEGQERRVSDIQS KAGISRESLV
Predicted Reactivity Dog : 100 %, Human : 100 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against WDR66. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name WDR66
Background WDR66 contains 9 WD repeats. The functions of WDR66 remain unknown.
Molecular Weight 130 kDa
Gene ID 144406
NCBI Accession NM_144668, NP_653269
UniProt Q8TBY9
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1149 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-WD Repeat Domain 66 (WDR66) (N-Term) antibody WB Suggested Anti-WDR66 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Validation Images
back to top