Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406291

Vacuolar Protein Sorting 37 Homolog A (S. Cerevisiae) (VPS37A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AW261445, D8Ertd531e, 2210018P21Rik, 4930592A21Rik, HCRP1, PQBP2, SPG53, fb08f03, fj42c03, zgc:73244, zgc:77637, wu:fb08f03, wu:fj42c03
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406291
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-VPS37A antibody: synthetic peptide directed towards the N terminal of human VPS37A
Sequence SWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHS SIAEIQKDVE
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Chicken : 92%, African clawed frog : 91%
Characteristics This is a rabbit polyclonal antibody against VPS37A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name VPS37A
Background VPS37A is a component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. VPS37A may be involved in cell growth and differentiation.
Molecular Weight 44kDa
Gene ID 137492
NCBI Accession NP_689628, NM_152415
UniProt Q8NEZ2
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-VPS37A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Eastman, Martin-Serrano, Chung et al.: "Identification of human VPS37C, a component of endosomal sorting complex required for transport-I important for viral budding." in: The Journal of biological chemistry, Vol. 280, Issue 1, pp. 628-36, 2004 (PubMed).

Alternatives for antigen "Vacuolar Protein Sorting 37 Homolog A (S. Cerevisiae) (VPS37A)", type "Antibodies"
Hosts (12)
Reactivities (11), (6), (6)
Applications (12), (7), (7), (3), (2), (2), (1)
Conjugates (2)
Epitopes (1), (1)
Beacon