Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406339

Membrane Protein, Palmitoylated 7 (MAGUK p55 Subfamily Member 7) (MPP7) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1110068J02Rik, 2810038M04Rik, 5430426E14Rik, AI415104, Gm955
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406339
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MPP7 antibody: synthetic peptide directed towards the N terminal of human MPP7
Sequence MPALSTGSGSDTGLYELLAALPAQLQPHVDSQEDLTFLWD MFGEKSLHSL
Predicted Reactivity Bovine : 100%, Chicken : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against MPP7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MPP7
Background MPP7 acts as an important adapter that promotes epithelial cell polarity and tight junction formation via its interaction with DLG1. MPP7 is involved in the assembly of protein complexes at sites of cell-cell contact.Membrane-associated guanylate kinases (MAGUKs) are important adaptor proteins involved in the assembly of protein complexes at sites of cell-cell contact. They are found in synapses, adherens junctions, and tight junctions. All MAGUKs contain at least 1 PDZ domain, an SH3 domain, and a GUK domain, and many contain 1 or 2 L27 domains, which are involved in multimerization of MAGUKs. MPP7 belongs to the p55 stardust subfamily of MAGUKs, which is named for a Drosophila gene required for establishment of cell polarity in the developing fly embryo (Bohl et al., 2007 [PubMed 17237226]).
Molecular Weight 65kDa
Gene ID 143098
NCBI Accession NP_775767, NM_173496
UniProt Q5T2T1
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MPP7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Stucke, Timmerman, Vandekerckhove et al.: "The MAGUK protein MPP7 binds to the polarity protein hDlg1 and facilitates epithelial tight junction formation." in: Molecular biology of the cell, Vol. 18, Issue 5, pp. 1744-55, 2007 (PubMed).

Alternatives for antigen "Membrane Protein, Palmitoylated 7 (MAGUK p55 Subfamily Member 7) (MPP7)", type "Antibodies"
Hosts (5), (1)
Reactivities (5), (2), (2)
Applications (6), (3), (3), (1)
Epitopes (1), (1)
Beacon