Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406372

ClpB Caseinolytic Peptidase B Homolog (E. Coli) (CLPB) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Skd3, AL118244, HSP78, SKD3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406372
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CLPB antibody: synthetic peptide directed towards the N terminal of human CLPB
Sequence QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGL GMCALAAALV
Predicted Reactivity Human : 100%, Dog : 92%, Horse : 92%, Mouse : 91%, Rat : 91%, Bovine : 85%, Rabbit : 84%
Characteristics This is a rabbit polyclonal antibody against CLPB. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CLPB
Background CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.
Molecular Weight 78kDa
Gene ID 81570
NCBI Accession NP_110440, NM_030813
UniProt Q9H078
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CLPB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "ClpB Caseinolytic Peptidase B Homolog (E. Coli) (CLPB)", type "Antibodies"
Hosts (10), (5)
Reactivities (12), (1), (1), (1), (1)
Applications (12), (7), (1)
Epitopes (6), (2), (2), (1), (1), (1), (1)
Beacon