Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406459

Inositol-Tetrakisphosphate 1-Kinase (ITPK1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Temt, ITRPK1, BC031182, zgc:56075, wu:fj15d08
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406459
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ITPK1 antibody: synthetic peptide directed towards the N terminal of human ITPK1
Sequence MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSL ELVHRFQEYI
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against ITPK1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ITPK1
Background ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. It probably acts as the rate-limiting enzyme of the InsP6 pathway. ITPK1 modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.
Molecular Weight 45kDa
Gene ID 3705
NCBI Accession NP_055031, NM_014216
UniProt Q13572
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ITPK1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Chamberlain, Qian, Stiles et al.: "Integration of inositol phosphate signaling pathways via human ITPK1." in: The Journal of biological chemistry, Vol. 282, Issue 38, pp. 28117-25, 2007 (PubMed).

Alternatives for antigen "Inositol-Tetrakisphosphate 1-Kinase (ITPK1)", type "Antibodies"
Hosts (28), (4)
Reactivities (30), (12), (3)
Applications (31), (15), (4), (4), (2), (1), (1), (1), (1)
Epitopes (5), (5), (4), (3), (1), (1)
Beacon