KIAA0892 (KIAA0892) (Middle Region) antibody

Details for Product No. ABIN406484, Supplier: Login to see New
New
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms scc4, mau-2, kiaa0892, 9130404D08Rik, A930019L04Rik, C77863, C79014, Mau-2, mKIAA0892, KIAA0892, MAU2L, SCC4
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Human, Mouse (Murine), Rat (Rattus), Xenopus laevis
(5), (3), (3)
Host
Rabbit
(4), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (1)
Pubmed 1 reference available
Supplier Login to see New
Catalog number from supplier Login to see New
Quantity 50 μg
Options
Shipping to United States ( )
Availability Will be delivered in 2 to 3 Business Days
Immunogen Synthetic peptide directed towards the middle region of human KIAA0892
Blocking Peptide Blocking peptide for this product available: KIAA0892 (KIAA0892) (Middle Region) peptide (ABIN978914)
Sequence MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQN GPNTSLASLL
Predicted Reactivity Rat :100 %,   Mouse :100 %,   Human :100 %,   Western clawed frog :90 %,   African clawed frog :90 %,   Green puffer :80 %,  
Characteristics This is a rabbit polyclonal antibody against KIAA0892. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KIAA0892 (KIAA0892 Antibody Abstract)
Background KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.
Molecular Weight 69 kDa
Gene ID 23383
NCBI Accession NP_056144, NM_015329
UniProt Q9Y6X3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 613 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
Western Blotting (WB) image for anti-KIAA0892 (KIAA0892) (Middle Region) antibody (ABIN406484) WB Suggested Anti-KIAA0892 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: ...
Product cited in: Seitan, Banks, Laval et al.: "Metazoan Scc4 homologs link sister chromatid cohesion to cell and axon migration guidance." in: PLoS biology, Vol. 4, Issue 8, pp. e242, 2006 (PubMed).

Catalog No. ABIN406484
$289.00
Plus shipping costs $45.00

Order hotline:

  • +1 877 302 8632
  • +1 888 205 9894 (TF)