Did you know that you can buy products from over 140 different suppliers from us?

KIAA0892 (KIAA0892) (Middle Region) antibody

Details for Product No. ABIN406484
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms scc4, mau-2, kiaa0892, 9130404D08Rik, A930019L04Rik, C77863, C79014, Mau-2, mKIAA0892, KIAA0892, MAU2L, SCC4
Epitope
Middle Region
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Human
(2)
Host
Rabbit
(2), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406484
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KIAA0892
Sequence MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQN GPNTSLASLL
Predicted Reactivity Rat :100 %,   Mouse :100 %,   Human :100 %,   Western clawed frog :90 %,   African clawed frog :90 %,   Green puffer :80 %,  
Characteristics This is a rabbit polyclonal antibody against KIAA0892. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KIAA0892
Background KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.
Molecular Weight 69 kDa
Gene ID 23383
NCBI Accession NM_015329, NP_056144
UniProt Q9Y6X3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 613 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-KIAA0892 (KIAA0892) (Middle Region) antibody WB Suggested Anti-KIAA0892 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Product cited in: Seitan, Banks, Laval et al.: "Metazoan Scc4 homologs link sister chromatid cohesion to cell and axon migration guidance." in: PLoS biology, Vol. 4, Issue 8, pp. e242, 2006 (PubMed).

Validation Images
back to top