Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406485

Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4632422M10Rik, A330090G21Rik, RGD1310204, zgc:165355
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406485
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PPWD1 antibody: synthetic peptide directed towards the middle region of human PPWD1
Sequence FMIQTGDPTGTGMGGESIWGGEFEDEFHSTLRHDRPYTLS MANAGSNTNG
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%, African clawed frog : 92%
Characteristics This is a rabbit polyclonal antibody against PPWD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PPWD1
Background PPWD1 is a putative peptidylprolyl isomerase (PPIase). PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPWD1 may be involved in pre-mRNA splicing.
Molecular Weight 73kDa
Gene ID 23398
NCBI Accession NP_056157, NM_015342
UniProt Q96BP3
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PPWD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jurica, Licklider, Gygi et al.: "Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis." in: RNA (New York, N.Y.), Vol. 8, Issue 4, pp. 426-39, 2002 (PubMed).

Alternatives for antigen "Peptidylprolyl Isomerase Domain and WD Repeat Containing 1 (PPWD1)", type "Antibodies"
Hosts (9), (8)
Reactivities (15), (3), (2), (2), (1)
Applications (16), (4), (3), (3), (1), (1)
Epitopes (2), (2), (1), (1), (1)
Beacon