Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406496

Coiled-Coil Domain Containing 69 (CCDC69) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms D11Ertd461e, 2210021E03Rik, RGD1562251, ccdc69, MGC83627, MGC147153
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406496
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCDC69 antibody: synthetic peptide directed towards the middle region of human CCDC69
Sequence TREALEKEVQLRRQLQQEKEELLYRVLGANASPAFPLAPV TPTEVSFLAT
Predicted Reactivity Human : 100%, Dog : 92%, Horse : 92%, Bovine : 85%, Rabbit : 85%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against CCDC69. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CCDC69
Background The function of CCDC69 remains unknown.
Molecular Weight 35kDa
Gene ID 26112
NCBI Accession NP_056436, NM_015621
UniProt A6NI79
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCDC69 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Suzuki, Yoshitomo-Nakagawa, Maruyama et al.: "Construction and characterization of a full length-enriched and a 5'-end-enriched cDNA library." in: Gene, Vol. 200, Issue 1-2, pp. 149-56, 1997 (PubMed).

Alternatives for antigen "Coiled-Coil Domain Containing 69 (CCDC69)", type "Antibodies"
Hosts (16), (9)
Reactivities (24), (11), (11), (9), (6)
Applications (16), (12), (9), (5), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (2), (2), (1), (1)
Beacon