Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406525

Ribose 5-Phosphate Isomerase A (RPIA) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RPI, MGC83218, F10A8.17, F10A8_17, ribose-5-phosphate isomerase 2, F7O18.28, F7O18_28, MFC16.20, MFC16_20, F23N20.9, F23N20_9, RADIAL SWELLING 10, RIBOSE 5-PHOSPHATE ISOMERASE
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406525
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RPIA antibody: synthetic peptide directed towards the N terminal of human RPIA
Sequence MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNSWDLPGSH VRLPGRAQSG
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against RPIA. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RPIA
Background Defects in RPIA are the cause of ribose 5-phosphate isomerase deficiency. The exact function of RPIA remains unknown.
Molecular Weight 33kDa
Gene ID 22934
NCBI Accession NP_653164, NM_144563
UniProt P49247
Research Area Cancer, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RPIA antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Huck, Verhoeven, Struys et al.: "Ribose-5-phosphate isomerase deficiency: new inborn error in the pentose phosphate pathway associated with a slowly progressive leukoencephalopathy." in: American journal of human genetics, Vol. 74, Issue 4, pp. 745-51, 2004 (PubMed).

Alternatives for antigen "Ribose 5-Phosphate Isomerase A (RPIA)", type "Antibodies"
Hosts (12), (4)
Reactivities (14), (6), (2)
Applications (16), (5), (3)
Epitopes (5), (2), (2), (2), (1), (1), (1)
Beacon