Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406558

HtrA Serine Peptidase 4 (HTRA4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1306242, B430206E18Rik
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406558
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HTRA4 antibody: synthetic peptide directed towards the middle region of human HTRA4
Sequence LKMHYPDFPDVSSGVYVCKVVEGTAAQSSGLRDHDVIVNI NGKPITTTTD
Predicted Reactivity Human : 100%, Dog : 92%, Horse : 92%, Pig : 92%, Rabbit : 92%, Bovine : 85%, Guinea pig : 85%, Mouse : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against HTRA4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HTRA4
Background HTRA4 is a member of the HtrA family of proteases. The protein contains a putative signal peptide, an insulin growth factor binding domain, a Kazal protease inhibitor domain, a conserved trypsin domain and a PDZ domain. Based on studies on other related family members, this enzyme may function as a secreted oligomeric chaperone protease to degrade misfolded secretory proteins. Other human HtrA proteins have been implicated in arthritis, tumor suppression, unfolded stress response, apoptosis, and aging.
Molecular Weight 51kDa
Gene ID 203100
NCBI Accession NP_710159, NM_153692
UniProt P83105
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HTRA4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Clausen, Southan, Ehrmann: "The HtrA family of proteases: implications for protein composition and cell fate." in: Molecular cell, Vol. 10, Issue 3, pp. 443-55, 2002 (PubMed).

Alternatives for antigen "HtrA Serine Peptidase 4 (HTRA4)", type "Antibodies"
Hosts (6), (2)
Reactivities (8), (2), (2)
Applications (8), (3), (1), (1), (1)
Epitopes (2), (2), (1)
Beacon