POC1 Centriolar Protein Homolog B (Chlamydomonas) (POC1B) (N-Term) antibody

Details for Product No. ABIN406560
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933430F16Rik, Wdr51b, PIX1, TUWD12, WDR51B
Epitope
N-Term
(4), (3), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(7)
Host
Rabbit
(8), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN406560
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human WDR51B
Sequence GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFS ADGQFLATAS
Predicted Reactivity Dog : 100 %
Characteristics This is a rabbit polyclonal antibody against WDR51B. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name WDR51B
Background WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.
Molecular Weight 54 kDa
Gene ID 282809
NCBI Accession NM_172240, NP_758440
UniProt Q8TC44
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 478 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-POC1 Centriolar Protein Homolog B (Chlamydomonas) (POC1B) (N-Term) antibody WB Suggested Anti-WDR51B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung
Background publications Higa, Wu, Ye et al.: "CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation." in: Nature cell biology, Vol. 8, Issue 11, pp. 1277-83, 2006 (PubMed).

Hosts (8), (1)
Reactivities (7)
Applications (8), (3), (2), (2), (1), (1)
Epitopes (4), (3), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top