Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406560

POC1 Centriolar Protein Homolog B (Chlamydomonas) (POC1B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4933430F16Rik, Wdr51b, PIX1, TUWD12, WDR51B
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406560
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-WDR51B antibody: synthetic peptide directed towards the N terminal of human WDR51B
Sequence GNLLASASRDRTVRLWIPDKRGKFSEFKAHTAPVRSVDFS ADGQFLATAS
Predicted Reactivity Dog : 100%
Characteristics This is a rabbit polyclonal antibody against WDR51B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name WDR51B
Background WDR51B contains 7 WD repeats. The function of the WDR51B protein remains unknown.
Molecular Weight 54kDa
Gene ID 282809
NCBI Accession NP_758440, NM_172240
UniProt Q8TC44
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-WDR51B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Higa, Wu, Ye et al.: "CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation." in: Nature cell biology, Vol. 8, Issue 11, pp. 1277-83, 2006 (PubMed).

Alternatives for antigen "POC1 Centriolar Protein Homolog B (Chlamydomonas) (POC1B)", type "Antibodies"
Hosts (7), (1)
Reactivities (6)
Applications (7), (3), (2), (2), (1), (1)
Epitopes (4), (4), (1), (1)
Beacon