Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406591

LysM, Putative Peptidoglycan-Binding, Domain Containing 1 (LYSMD1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2610022K04Rik, AI415311, RP11-68I18.5, zgc:153301, LYSMD1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406591
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LYSMD1 antibody: synthetic peptide directed towards the N terminal of human LYSMD1
Sequence VRERRLEHQLEPGDTLAGLALKYGVTMEQIKRANRLYTND SIFLKKTLYI
Predicted Reactivity Mouse : 100%, Rabbit : 100%, Dog : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against LYSMD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LYSMD1
Background The specific function of this protein remains unknown.
Molecular Weight 25kDa
Gene ID 388695
NCBI Accession NP_997716, NM_212551
UniProt Q96S90
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LYSMD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gregory, Barlow, McLay et al.: "The DNA sequence and biological annotation of human chromosome 1." in: Nature, Vol. 441, Issue 7091, pp. 315-21, 2006 (PubMed).

Alternatives for antigen "LysM, Putative Peptidoglycan-Binding, Domain Containing 1 (LYSMD1)", type "Antibodies"
Hosts (5)
Reactivities (4), (3)
Applications (5), (3), (1)
Epitopes (3), (2), (1), (1)
Beacon