Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406640

V-Ets erythroblastosis Virus E26 Oncogene Homolog (Avian) (ERG) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms p55, erg-3, erg, erg_A, zgc:103429, ERG, erg_E
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN406640
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ERG antibody: synthetic peptide directed towards the N terminal of human ERG
Sequence IMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLP YMGSYHAHPQ
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, African clawed frog : 85%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against ERG. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ERG
Background V-ets erythroblastosis virus E26 oncogene like isoform 2 (ERG) is a transcriptional regulator. It may participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.
Molecular Weight 52kDa
Gene ID 2078
NCBI Accession NP_004440, NM_004449
UniProt P11308
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Hematopoietic Progenitors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ERG antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "V-Ets erythroblastosis Virus E26 Oncogene Homolog (Avian) (ERG)", type "Antibodies"
Hosts (25), (20), (9)
Reactivities (50), (12), (10), (1), (1), (1), (1), (1)
Applications (36), (23), (14), (11), (6), (3), (1), (1)
Conjugates (1)
Epitopes (9), (2), (2), (1), (1), (1), (1), (1)
Beacon