Did you know that you can buy products from over 140 different suppliers from us?

V-Ets erythroblastosis Virus E26 Oncogene Homolog (Avian) (ERG) (N-Term) antibody

Details for Product No. ABIN406640
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms p55, erg-3, erg, erg_A, zgc:103429, ERG, erg_E
Epitope
N-Term
(9), (3), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(54), (13), (11), (1), (1), (1), (1), (1)
Host
Rabbit
(27), (22), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1)
Application
Western Blotting (WB)
(40), (21), (13), (11), (7), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406640
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ERG
Sequence IMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLP YMGSYHAHPQ
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, African clawed frog : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against ERG. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ERG
Background V-ets erythroblastosis virus E26 oncogene like isoform 2 (ERG) is a transcriptional regulator. It may participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.
Molecular Weight 52 kDa
Gene ID 2078
NCBI Accession NM_004449, NP_004440
UniProt P11308
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Hematopoietic Progenitors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 462 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-V-Ets erythroblastosis Virus E26 Oncogene Homolog (Avian) (ERG) (N-Term) antibody WB Suggested Anti-ERG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
anti-V-Ets erythroblastosis Virus E26 Oncogene Homolog (Avian) (ERG) (N-Term) antibody (2) anti-V-Ets erythroblastosis Virus E26 Oncogene Homolog (Avian) (ERG) (N-Term) antibody (Image 2)
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406640
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top