Did you know that you can buy products from over 140 different suppliers from us?

Galanin Prepropeptide (GAL) (Middle Region) antibody

Details for Product No. ABIN406754
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Galn, GAL-GMAP, GALN, GLNN, GMAP, xgal, galanin
Epitope
Middle Region
(1)
Reactivity
Dog (Canine), Human
(7), (1)
Host
Rabbit
(6), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (6), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN406754
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GAL
Sequence LNSAGYLLGPHAVGNHRSFSDKNGLTSKRELRPEDDMKPG SFDRSIPENN
Predicted Reactivity Human : 100 %, Dog : 70 %
Characteristics This is a rabbit polyclonal antibody against GAL. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GAL
Background Galanin is small neuropeptide that functions as a cellular messenger within the central and peripheral nervous systems, modulating diverse physiologic functions.
Molecular Weight 13 kDa
Gene ID 51083
NCBI Accession NM_015973, NP_057057
UniProt P22466
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 123 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Galanin Prepropeptide (GAL) (Middle Region) antibody WB Suggested Anti-GAL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
Product cited in: Levran, Londono, OHara et al.: "Genetic susceptibility to heroin addiction: a candidate gene association study." in: Genes, brain, and behavior, Vol. 7, Issue 7, pp. 720-9, 2009 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406754
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top