Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN486846

SRY (Sex Determining Region Y)-Box 21 (SOX21) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Sox25, SOX25, CG7345, Dmel\\CG7345, SOXB2.3, Sox B2-3, Sox21, SoxB2.3, sox25
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN486846
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SOX21 antibody: synthetic peptide directed towards the middle region of human SOX21
Sequence EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPA LKAGAGLHAG
Predicted Reactivity Bovine : 100%, Chicken : 100%, Human : 100%, Mouse : 100%, African clawed frog : 84%
Characteristics This is a rabbit polyclonal antibody against SOX21. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SOX21
Background SRY-related HMG-box (SOX) genes encode a family of DNA-binding proteins containing a 79-amino acid HMG (high mobility group) domain that shares at least 50% sequence identity with the DNA-binding HMG box of the SRY protein (MIM 480000). SOX proteins are d
Molecular Weight 28kDa
Gene ID 11166
NCBI Accession NP_009015, NM_007084
UniProt Q9Y651
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Neurogenesis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SOX21 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Schepers, Teasdale, Koopman: "Twenty pairs of sox: extent, homology, and nomenclature of the mouse and human sox transcription factor gene families." in: Developmental cell, Vol. 3, Issue 2, pp. 167-70, 2002 (PubMed).

Alternatives for antigen "SRY (Sex Determining Region Y)-Box 21 (SOX21)", type "Antibodies"
Hosts (13), (4), (3)
Reactivities (20), (13), (13), (12), (12)
Applications (11), (10), (10), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1)
Beacon