Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger and BTB Domain Containing 4 (ZBTB4) (Middle Region) antibody

Details for Product No. ABIN487027
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310026P19Rik, 9230111I22Rik, RP23-422L16.16, mKIAA1538, KAISO-L1, ZNF903
Epitope
Middle Region
(10), (7), (3)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(39), (19), (12), (12), (12), (12)
Host
Rabbit
(39)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(30), (23), (12), (10), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487027
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZBTB4
Sequence RPGGTPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGE AGGGSTAAEE
Predicted Reactivity Human : 100 %, Guinea pig : 90 %, Horse : 90 %, Dog : 80 %, Mouse : 80 %, Rabbit : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against ZBTB4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZBTB4
Background ZBTB4 may be involved in transcriptional regulation.
Molecular Weight 105 kDa
Gene ID 57659
NCBI Accession NM_020899, NP_065950
UniProt Q9P1Z0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1013 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Weber, Marquardt, Elzi et al.: "Zbtb4 represses transcription of P21CIP1 and controls the cellular response to p53 activation." in: The EMBO journal, Vol. 27, Issue 11, pp. 1563-74, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487027
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top