Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487027

Zinc Finger and BTB Domain Containing 4 (ZBTB4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2310026P19Rik, 9230111I22Rik, RP23-422L16.16, mKIAA1538, KAISO-L1, ZNF903
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487027
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB4 antibody: synthetic peptide directed towards the middle region of human ZBTB4
Sequence RPGGTPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGE AGGGSTAAEE
Predicted Reactivity Human : 100%, Guinea pig : 92%, Horse : 92%, Dog : 85%, Mouse : 85%, Rabbit : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against ZBTB4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZBTB4
Background ZBTB4 may be involved in transcriptional regulation.
Molecular Weight 105kDa
Gene ID 57659
NCBI Accession NP_065950, NM_020899
UniProt Q9P1Z0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZBTB4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Weber, Marquardt, Elzi et al.: "Zbtb4 represses transcription of P21CIP1 and controls the cellular response to p53 activation." in: The EMBO journal, Vol. 27, Issue 11, pp. 1563-74, 2008 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 4 (ZBTB4)", type "Antibodies"
Hosts (36)
Reactivities (36), (19), (12), (12), (12), (12)
Applications (27), (16), (11), (10), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (4), (2), (1), (1)
Beacon