Did you know that you can buy products from over 140 different suppliers from us?

ALX Homeobox 4 (ALX4) (Middle Region) antibody

Details for Product No. ABIN487039
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms lst, FND2, im:7142878, zgc:162606, alx4
Epitope
Middle Region
(8), (8), (6), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(33), (12), (6), (4), (3)
Host
Rabbit
(27), (11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(37), (11), (10), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487039
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ALX4
Sequence GQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMK AKEHSAAISW
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 90 %, Rat : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against ALX4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ALX4
Background ALX4 is a member of the ALX homeobox gene family in humans. The paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members.
Molecular Weight 44 kDa
Gene ID 60529
NCBI Accession NM_021926, NP_068745
UniProt Q9H161
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 411 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Sladek, Rocheleau, Rung et al.: "A genome-wide association study identifies novel risk loci for type 2 diabetes." in: Nature, Vol. 445, Issue 7130, pp. 881-5, 2007 (PubMed).

Hosts (27), (11)
Reactivities (33), (12), (6), (4), (3)
Applications (37), (11), (10), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (8), (8), (6), (2), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487039
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top