Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487039

ALX Homeobox 4 (ALX4) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms lst, FND2, im:7142878, zgc:162606, alx4
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487039
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ALX4 antibody: synthetic peptide directed towards the middle region of human ALX4
Sequence GQTHMGSLFGAASLSPGLNGYELNGEPDRKTSSIAALRMK AKEHSAAISW
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 92%, Rat : 92%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against ALX4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ALX4
Background ALX4 is a member of the ALX homeobox gene family in humans. The paired-type homeodomain has been shown to mediate high-affinity sequence-specific DNA binding to palindromic elements as either homodimers or as heterodimers with other family members.
Molecular Weight 44kDa
Gene ID 60529
NCBI Accession NP_068745, NM_021926
UniProt Q9H161
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ALX4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Sladek, Rocheleau, Rung et al.: "A genome-wide association study identifies novel risk loci for type 2 diabetes." in: Nature, Vol. 445, Issue 7130, pp. 881-5, 2007 (PubMed).

Alternatives for antigen "ALX Homeobox 4 (ALX4)", type "Antibodies"
Hosts (18), (11)
Reactivities (24), (10), (5), (4), (3)
Applications (28), (5), (2), (2), (1)
Epitopes (6), (3), (2), (2), (2), (2), (1)
Beacon