Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487057

Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tcfl1, si:dkeyp-24a7.1, YL1, CFL1, Swc2, YL-1, TCFL1, CG4621, Dmel\\CG4621, dYL-1, vps72, MGC82727, Vps72, ACYPI009531
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487057
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-VPS72 antibody: synthetic peptide directed towards the N terminal of human VPS72
Sequence GGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGE AEEPRRKRRV
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 76%
Characteristics This is a rabbit polyclonal antibody against VPS72. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name VPS72
Background VPS72 could be a DNA-binding transcriptional regulator. VPS72 may be involved in chromatin modification and remodeling.
Molecular Weight 40kDa
Gene ID 6944
NCBI Accession NP_005988, NM_005997
UniProt Q15906
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-VPS72 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).

Alternatives for antigen "Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72)", type "Antibodies"
Hosts (22), (4)
Reactivities (25), (15), (4), (2), (2), (2), (2), (2)
Applications (26), (13), (7), (3), (3), (1), (1)
Epitopes (4), (3), (3), (2), (1)
Beacon