Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72) (N-Term) antibody

Details for Product No. ABIN487057
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tcfl1, si:dkeyp-24a7.1, YL1, CFL1, Swc2, YL-1, TCFL1, CG4621, Dmel\\CG4621, dYL-1, vps72, MGC82727, Vps72, ACYPI009531
Epitope
N-Term
(3), (3), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(28), (17), (5), (2), (2), (2), (2), (2)
Host
Rabbit
(25), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(29), (13), (9), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN487057
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human VPS72
Sequence GGFTEESGDDEYQGDQSDTEDEVDSDFDIDEGDEPSSDGE AEEPRRKRRV
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against VPS72. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name VPS72
Background VPS72 could be a DNA-binding transcriptional regulator. VPS72 may be involved in chromatin modification and remodeling.
Molecular Weight 40 kDa
Gene ID 6944
NCBI Accession NM_005997, NP_005988
UniProt Q15906
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 364 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Vacuolar Protein Sorting 72 Homolog (S. Cerevisiae) (VPS72) (N-Term) antibody WB Suggested Anti-VPS72 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: ACHN cell lysate
Background publications Denoeud, Kapranov, Ucla et al.: "Prominent use of distal 5' transcription start sites and discovery of a large number of additional exons in ENCODE regions." in: Genome research, Vol. 17, Issue 6, pp. 746-59, 2007 (PubMed).

Hosts (25), (4)
Reactivities (28), (17), (5), (2), (2), (2), (2), (2)
Applications (29), (13), (9), (3), (3), (2)
Epitopes (3), (3), (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top