Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487200

Family with Sequence Similarity 3, Member C (FAM3C) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ILEI, Ilei, D6Wsu176e, zgc:55444, zgc:77090, wu:fb99h11, wu:fi35h03
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN487200
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM3C antibody: synthetic peptide directed towards the C terminal of human FAM3C
Sequence DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEME GCIPQKQD
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Rat : 100%, Horse : 92%, Mouse : 92%, Rabbit : 90%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against FAM3C. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM3C
Background FAM3C is a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells.This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. Alternate transcriptional splice variants which encode the same protein have been characterized.
Molecular Weight 22kDa
Gene ID 10447
NCBI Accession NP_001035109, NM_001040020
UniProt Q92520
Research Area Immunology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM3°Cantibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Dublineau, Grison, Grandcolas et al.: "Absorption, accumulation and biological effects of depleted uranium in Peyer's patches of rats." in: Toxicology, Vol. 227, Issue 3, pp. 227-39, 2006 (PubMed).

Background publications Waerner, Alacakaptan, Tamir et al.: "ILEI: a cytokine essential for EMT, tumor formation, and late events in metastasis in epithelial cells." in: Cancer cell, Vol. 10, Issue 3, pp. 227-39, 2006 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 3, Member C (FAM3C)", type "Antibodies"
Hosts (25), (2)
Reactivities (24), (19), (16), (16), (16), (15), (11), (3), (3), (2), (1), (1), (1)
Applications (17), (9), (9), (8), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (1)
Beacon