Family with Sequence Similarity 3, Member C (FAM3C) (C-Term) antibody

Details for Product No. ABIN487200
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ILEI, Ilei, D6Wsu176e, zgc:55444, zgc:77090, wu:fb99h11, wu:fi35h03
Epitope
C-Term
(3), (2), (2), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
(23), (19), (16), (14), (14), (13), (11), (2), (1), (1), (1), (1), (1)
Host
Rabbit
(24), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(16), (9), (8), (6), (1), (1), (1)
Pubmed 2 references available
Catalog no. ABIN487200
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FAM3C
Sequence DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEME GCIPQKQD
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Rat : 100 %, Horse : 90 %, Mouse : 90 %, Rabbit : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against FAM3C. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM3C
Background FAM3C is a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells.This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. Alternate transcriptional splice variants which encode the same protein have been characterized.
Molecular Weight 22 kDa
Gene ID 10447
NCBI Accession NM_001040020, NP_001035109
UniProt Q92520
Research Area Immunology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 227 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 3, Member C (FAM3C) (C-Term) antibody WB Suggested Anti-FAM3C Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Product cited in: Dublineau, Grison, Grandcolas et al.: "Absorption, accumulation and biological effects of depleted uranium in Peyer's patches of rats." in: Toxicology, Vol. 227, Issue 3, pp. 227-39, 2006 (PubMed).

Background publications Waerner, Alacakaptan, Tamir et al.: "ILEI: a cytokine essential for EMT, tumor formation, and late events in metastasis in epithelial cells." in: Cancer cell, Vol. 10, Issue 3, pp. 227-39, 2006 (PubMed).

Hosts (24), (2)
Reactivities (23), (19), (16), (14), (14), (13), (11), (2), (1), (1), (1), (1), (1)
Applications (16), (9), (8), (6), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (1)
back to top