Did you know that you can buy products from over 140 different suppliers from us?

Family with Sequence Similarity 20, Member C (FAM20C) (C-Term) antibody

Details for Product No. ABIN487229
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DMP-4, DMP4, GEF-CK, RNS, C76981, mKIAA4081, RGD1311980
Epitope
C-Term
(10), (10), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(26), (13), (13), (13), (13), (12)
Host
Rabbit
(28)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (10), (10), (8), (5)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN487229
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human FAM20C
Sequence NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYL RLQLLAKEEY
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Rat : 100 %, Bovine : 90 %, Rabbit : 90 %
Characteristics This is a rabbit polyclonal antibody against FAM20C. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM20C
Background FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.
Molecular Weight 66 kDa
Gene ID 56975
NCBI Accession NM_020223, NP_064608
UniProt Q8IXL6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 584 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 20, Member C (FAM20C) (C-Term) antibody WB Suggested Anti-FAM20C Antibody Titration: 0.2-1 ug/ml
Positive Control: NTERA2 cell lysate
Background publications Simpson, Hsu, Keir et al.: "Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine syndrome), highlighting a crucial molecule in bone development." in: American journal of human genetics, Vol. 81, Issue 5, pp. 906-12, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN487229
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top