Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN487281

OTU Domain Containing 6B (OTUD6B) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DUBA5, 2600013N14Rik, AU015433, RGD1310024, zgc:56305, duba5, DKFZp459J184
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN487281
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OTUD6B antibody: synthetic peptide directed towards the middle region of human OTUD6B
Sequence EIIQADSPPIIVGEEYSKKPLILVYMRHAYGLGEHYNSVT RLVNIVTENC
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against OTUD6B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name OTUD6B
Background Deubiquitinating enzymes (DUBs, see MIM 603478) are proteases that specifically cleave ubiquitin (MIM 191339) linkages, negating the action of ubiquitin ligases. DUBA5 belongs to a DUB subfamily characterized by an ovarian tumor (OTU) domain.
Molecular Weight 37kDa
Gene ID 51633
NCBI Accession NP_057107, NM_015976
UniProt Q8N6M0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OTUD6B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Worby, Dixon: "Sorting out the cellular functions of sorting nexins." in: Nature reviews. Molecular cell biology, Vol. 3, Issue 12, pp. 919-31, 2002 (PubMed).

Alternatives for antigen "OTU Domain Containing 6B (OTUD6B)", type "Antibodies"
Hosts (6)
Reactivities (5), (3)
Applications (6), (3), (1)
Epitopes (3), (2), (1), (1)
Beacon