Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501301

Kelch-Like 3 (Drosophila) (KLHL3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PHA2D, RGD1565218, 7530408C15Rik, AI430941, EG627648
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN501301
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KLHL3 antibody: synthetic peptide directed towards the N terminal of human KLHL3
Sequence CSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYT AEIEVTEENV
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Chicken : 92%, Dog : 85%
Characteristics This is a rabbit polyclonal antibody against KLHL3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KLHL3
Background KLHL3 protein contains a poxvirus and zinc finger domain at the N-terminus and six tandem repeats (kelch repeats) at the C-terminus. At the amino acid level, KLHL3 shares 77% similarity with Drosophila kelch and 89% similarity with Mayven (KLHL2), another human kelch homolog. At least three isoforms are produced and may be the result of alternative promoter usage. The KLHL3 maps within the smallest commonly deleted segment in myeloid leukemias characterized by a deletion of 5q, however, no inactivating mutations of KLHL3 could be detected in malignant myeloid disorders with loss of 5q.
Molecular Weight 65kDa
Gene ID 26249
NCBI Accession NP_059111, NM_017415
UniProt Q9UH77
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KLHL3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Schmutz, Martin, Terry et al.: "The DNA sequence and comparative analysis of human chromosome 5." in: Nature, Vol. 431, Issue 7006, pp. 268-74, 2004 (PubMed).

Alternatives for antigen "Kelch-Like 3 (Drosophila) (KLHL3)", type "Antibodies"
Hosts (31), (3)
Reactivities (34), (15), (15), (13), (12), (12), (11), (1), (1)
Applications (20), (14), (10), (9), (4), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (2), (2), (2), (1), (1), (1), (1)
Beacon