Kelch-Like 3 (Drosophila) (KLHL3) (N-Term) antibody

Details for Product No. ABIN501301
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PHA2D, RGD1565218, 7530408C15Rik, AI430941, EG627648
Epitope
N-Term
(9), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(37), (15), (15), (12), (11), (11), (11)
Host
Rabbit
(34), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(23), (15), (13), (9), (6), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN501301
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KLHL3
Sequence CSPYFCAMFTGDMSESKAKKIEIKDVDGQTLSKLIDYIYT AEIEVTEENV
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against KLHL3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KLHL3
Background KLHL3 protein contains a poxvirus and zinc finger domain at the N-terminus and six tandem repeats (kelch repeats) at the C-terminus. At the amino acid level, KLHL3 shares 77 % similarity with Drosophila kelch and 87 % similarity with Mayven (KLHL2), another human kelch homolog. At least three isoforms are produced and may be the result of alternative promoter usage. The KLHL3 maps within the smallest commonly deleted segment in myeloid leukemias characterized by a deletion of 5q, however, no inactivating mutations of KLHL3 could be detected in malignant myeloid disorders with loss of 5q.
Molecular Weight 65 kDa
Gene ID 26249
NCBI Accession NM_017415, NP_059111
UniProt Q9UH77
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 587 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kelch-Like 3 (Drosophila) (KLHL3) (N-Term) antibody WB Suggested Anti-KLHL3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: THP-1 cell lysate
Background publications Schmutz, Martin, Terry et al.: "The DNA sequence and comparative analysis of human chromosome 5." in: Nature, Vol. 431, Issue 7006, pp. 268-74, 2004 (PubMed).

Hosts (34), (3)
Reactivities (37), (15), (15), (12), (11), (11), (11)
Applications (23), (15), (13), (9), (6), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (2), (2), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top