Potassium Voltage-Gated Channel, Shaker-Related Subfamily, Member 1 (Episodic Ataxia with Myokymia) (KCNA1) (Middle Region) antibody

Details for Product No. ABIN501356
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI840627, Kca1-1, Kv1.1, MBK1, Mk-1, Shak, mceph, Kcna, Kcpvd, AEMK, EA1, HBK1, HUK1, KV1.1, MK1, RBK1, KCNA1
Epitope
Middle Region
(9), (8), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Human
(53), (38), (37), (12), (12), (12), (4)
Host
Rabbit
(45), (17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(53), (22), (18), (10), (9), (5), (5), (4), (4), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN501356
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KCNA1
Sequence ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFT DPFFIVETLC
Predicted Reactivity Dog : 100 %, Human : 100 %, Pig : 100 %, Mouse : 90 %, Rat : 90 %, Horse : 80 %
Characteristics This is a rabbit polyclonal antibody against KCNA1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCNA1
Background KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK). Sequence Note: This RefSeq record was created largely from genomic sequence because transcripts were not available for the entire length of the gene. This transcript is supported by sequences from mouse.
Molecular Weight 56 kDa
Gene ID 3736
NCBI Accession NM_000217, NP_000208
UniProt Q09470
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 495 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Tan, Lennon, Klein et al.: "Clinical spectrum of voltage-gated potassium channel autoimmunity." in: Neurology, Vol. 70, Issue 20, pp. 1883-90, 2008 (PubMed).

Hosts (45), (17)
Reactivities (53), (38), (37), (12), (12), (12), (4)
Applications (53), (22), (18), (10), (9), (5), (5), (4), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (8), (4), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top