Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3) (Middle Region) antibody

Details for Product No. ABIN501384
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AU019351, C030044P22Rik, Elk2, Kv12.2, Melk2, Bec1, BEC1, ELK2
Epitope
Middle Region
(4), (3), (1)
Reactivity
Human
(10), (6), (5), (1)
Host
Rabbit
(13)
Clonality
Polyclonal
Application
Western Blotting (WB)
(13), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN501384
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KCNH3
Sequence SGDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGC TSSSSAAKLL
Predicted Reactivity Horse : 100 %, Human : 100 %, Dog : 90 %, Guinea pig : 90 %, Mouse : 90 %, Bovine : 80 %, Pig : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against KCNH3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCNH3
Background The exact function of this protein remains unknown.
Molecular Weight 117 kDa
Gene ID 23416
NCBI Accession NM_012284, NP_036416
UniProt Q9ULD8
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1083 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Potassium Voltage-Gated Channel, Subfamily H (Eag-Related), Member 3 (Kcnh3) (Middle Region) antibody WB Suggested Anti-KCNH3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: OVCAR-3 cell lysate
Background publications Gutman, Chandy, Grissmer et al.: "International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels." in: Pharmacological reviews, Vol. 57, Issue 4, pp. 473-508, 2005 (PubMed).

Hosts (13)
Reactivities (10), (6), (5), (1)
Applications (13), (3), (1), (1)
Epitopes (4), (3), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top