Potassium Channel Tetramerisation Domain Containing 15 (KCTD15) (N-Term) antibody

Details for Product No. ABIN501400
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC031749, kctd15, zgc:100865
Epitope
N-Term
(11), (4), (3), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Human, Chicken
(30), (13), (13)
Host
Rabbit
(18), (13)
Clonality
Polyclonal
Application
Western Blotting (WB)
(28), (19), (12), (7), (5), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN501400
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KCTD15
Sequence PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLT KYPDSRISRL
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against KCTD15. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCTD15
Background KCTD15 contains 1 BTB (POZ) domain. The exact function of KCTD15 is not known.
Molecular Weight 26 kDa
Gene ID 79047
NCBI Accession NM_024076, NP_076981
UniProt Q96SI1-2
Research Area Signaling, Metabolism, Transporters
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 234 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Potassium Channel Tetramerisation Domain Containing 15 (KCTD15) (N-Term) antibody WB Suggested Anti-KCTD15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Background publications Ballif, Villén, Beausoleil et al.: "Phosphoproteomic analysis of the developing mouse brain." in: Molecular & cellular proteomics : MCP, Vol. 3, Issue 11, pp. 1093-101, 2004 (PubMed).

Hosts (18), (13)
Reactivities (30), (13), (13)
Applications (28), (19), (12), (7), (5), (2), (1)
Epitopes (11), (4), (3), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top