Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501400

Potassium Channel Tetramerisation Domain Containing 15 (KCTD15) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BC031749, kctd15, zgc:100865
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501400
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCTD15 antibody: synthetic peptide directed towards the N terminal of human KCTD15
Sequence PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLT KYPDSRISRL
Predicted Reactivity Chicken : 100%, Dog : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against KCTD15. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KCTD15
Background KCTD15 contains 1 BTB (POZ) domain. The exact function of KCTD15 is not known.
Molecular Weight 26kDa
Gene ID 79047
NCBI Accession NP_076981, NM_024076
UniProt Q96SI1-2
Research Area Signaling, Metabolism, Transporters
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCTD15 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ballif, Villén, Beausoleil et al.: "Phosphoproteomic analysis of the developing mouse brain." in: Molecular & cellular proteomics : MCP, Vol. 3, Issue 11, pp. 1093-101, 2004 (PubMed).

Alternatives for antigen "Potassium Channel Tetramerisation Domain Containing 15 (KCTD15)", type "Antibodies"
Hosts (17), (10)
Reactivities (29), (13), (12)
Applications (27), (18), (12), (7), (5), (2), (1)
Epitopes (11), (4), (3), (2), (1)
Beacon