Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501432

BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AU017169, 2210017A09Rik, bA321C24.3, wu:fk37b10, zgc:92463
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN501432
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCTD4 antibody: synthetic peptide directed towards the N terminal of human KCTD4
Sequence MTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDAD GHYFIDRDGL
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Chicken : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against KCTD4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KCTD4
Background KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.
Molecular Weight 30kDa
Gene ID 386618
NCBI Accession NP_940686, NM_198404
UniProt Q8WVF5
Research Area Signaling, Metabolism, Transporters
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCTD4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4)", type "Antibodies"
Hosts (12), (5)
Reactivities (14), (4), (2), (2), (2), (2), (1)
Applications (17), (4), (4), (2), (1)
Epitopes (5), (2), (2), (1)
Beacon