Atonal Homolog 7 (Drosophila) (ATOH7) (C-Term) antibody

Details for Product No. ABIN501515
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Math5, bHLHa13, ath5, zath5, ATH5, ATOH7
Epitope
C-Term
(3), (3), (1), (1), (1)
Reactivity
Human
(7), (6), (2), (2)
Host
Rabbit
(7), (7), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (5), (2)
Pubmed 1 reference available
Catalog no. ABIN501515
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ATOH7
Sequence FGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLF GFQPEPFQMA
Predicted Reactivity Human : 100 %, Dog : 80 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against ATOH7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ATOH7
Background ATOH7 is a transcription factor involved in the differentiation of retinal ganglion cells.ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila 'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).
Molecular Weight 17 kDa
Gene ID 220202
NCBI Accession NM_145178, NP_660161
UniProt Q8N100
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 152 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Atonal Homolog 7 (Drosophila) (ATOH7) (C-Term) antibody WB Suggested Anti-ATOH7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate
Product cited in: McLellan, Langlands, Kealey: "Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening." in: Mechanisms of development, Vol. 119 Suppl 1, pp. S285-91, 2003 (PubMed).

Hosts (7), (7), (2)
Reactivities (7), (6), (2), (2)
Applications (9), (5), (2)
Epitopes (3), (3), (1), (1), (1)
back to top