Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501515

Atonal Homolog 7 (Drosophila) (ATOH7) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Math5, bHLHa13, ath5, zath5, ATH5, ATOH7
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501515
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ATOH7 antibody: synthetic peptide directed towards the C terminal of human ATOH7
Sequence FGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLF GFQPEPFQMA
Predicted Reactivity Human : 100%, Dog : 84%, Bovine : 76%
Characteristics This is a rabbit polyclonal antibody against ATOH7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ATOH7
Background ATOH7 is a transcription factor involved in the differentiation of retinal ganglion cells.ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila 'atonal,' a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).
Molecular Weight 17kDa
Gene ID 220202
NCBI Accession NP_660161, NM_145178
UniProt Q8N100
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ATOH7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: McLellan, Langlands, Kealey: "Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening." in: Mechanisms of development, Vol. 119 Suppl 1, pp. S285-91, 2003 (PubMed).

Alternatives for antigen "Atonal Homolog 7 (Drosophila) (ATOH7)", type "Antibodies"
Hosts (11), (7), (5)
Reactivities (10), (8), (3), (1)
Applications (14), (13), (1), (1), (1)
Epitopes (4), (3), (2), (1), (1), (1)
Beacon