Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501581

Cytokine Receptor-Like Factor 1 (CRLF1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CLF, NR6, CISS, CISS1, CLF-1, zcytor5, CRLM3, NR6.1, clf-1.a, wu:fd24a10, zgc:91992, CRLF1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501581
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CRLF1 antibody: synthetic peptide directed towards the middle region of human CRLF1
Sequence QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVS NQTSCRLAGL
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against CRLF1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CRLF1
Background CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development.Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.
Molecular Weight 46kDa
Gene ID 9244
NCBI Accession NP_004741, NM_004750
UniProt O75462
Research Area Immunology, Innate Immunity, Cytokines
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CRLF1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Crisponi, Crisponi, Meloni et al.: "Crisponi syndrome is caused by mutations in the CRLF1 gene and is allelic to cold-induced sweating syndrome type 1." in: American journal of human genetics, Vol. 80, Issue 5, pp. 971-81, 2007 (PubMed).

Alternatives for antigen "Cytokine Receptor-Like Factor 1 (CRLF1)", type "Antibodies"
Hosts (25), (8)
Reactivities (32), (12), (12), (12), (12), (12), (12)
Applications (23), (10), (9), (3), (3), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (3), (3), (2), (1), (1), (1), (1)
Beacon