Did you know that you can buy products from over 140 different suppliers from us?

Engrailed Homeobox 1 (EN1) (Middle Region) antibody

Details for Product No. ABIN501632
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EN1, En-1, Mo-en.1, ENG-1, en-1, en1, eng1, zgc:100771, en1-A, engrailed-1, xen1, Gg-En-1, en-3
Epitope
Middle Region
(2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(6), (1)
Host
Rabbit
(4), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (3), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501632
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EN1
Sequence LNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHS TTTVQDKDES
Predicted Reactivity Dog : 100 %, Guinea pig : 100 %, Pig : 100 %, Rabbit : 100 %, Chicken : 90 %, African clawed frog : 80 %
Characteristics This is a rabbit polyclonal antibody against EN1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EN1
Background Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Differe
Molecular Weight 40 kDa
Gene ID 2019
NCBI Accession NM_001426, NP_001417
UniProt Q05925
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 392 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Engrailed Homeobox 1 (EN1) (Middle Region) antibody WB Suggested Anti-EN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate
Background publications Atit, Sgaier, Mohamed et al.: "Beta-catenin activation is necessary and sufficient to specify the dorsal dermal fate in the mouse." in: Developmental biology, Vol. 296, Issue 1, pp. 164-76, 2006 (PubMed).

Validation Images
back to top