Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501632

Engrailed Homeobox 1 (EN1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ENG-1, en-1, en1, eng1, zgc:100771, Gg-En-1, en-3, EN1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501632
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EN1 antibody: synthetic peptide directed towards the middle region of human EN1
Sequence LNESQIKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHS TTTVQDKDES
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Pig : 100%, Rabbit : 100%, Chicken : 92%, African clawed frog : 80%
Characteristics This is a rabbit polyclonal antibody against EN1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EN1
Background Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Differe
Molecular Weight 40kDa
Gene ID 2019
NCBI Accession NP_001417, NM_001426
UniProt Q05925
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EN1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Atit, Sgaier, Mohamed et al.: "Beta-catenin activation is necessary and sufficient to specify the dorsal dermal fate in the mouse." in: Developmental biology, Vol. 296, Issue 1, pp. 164-76, 2006 (PubMed).

Alternatives for antigen "Engrailed Homeobox 1 (EN1)", type "Antibodies"
Hosts (7), (4)
Reactivities (10), (2)
Applications (11), (5), (5), (2), (1)
Epitopes (2), (2), (2), (1), (1), (1)
Beacon