Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 133 (ZNF133) (N-Term) antibody

Details for Product No. ABIN501661
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF150, pHZ-13, pHZ-66, Znf133
Epitope
N-Term
(11), (9), (6), (4), (2), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(31), (1)
Host
Rabbit
(18), (13)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(31), (17), (6), (4), (2), (1), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501661
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF133
Sequence MAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYSNLVSL GISFSKPELI
Predicted Reactivity Human : 100 %, Bovine : 90 %, Horse : 80 %, Pig : 80 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against ZNF133. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF133
Background ZNF133 may be involved in transcriptional regulation as a repressor.
Molecular Weight 73 kDa
Gene ID 7692
NCBI Accession NM_003434, NP_003425
UniProt Q53XU1
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 653 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 133 (ZNF133) (N-Term) antibody WB Suggested Anti-ZNF133 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate
Product cited in: Westphalen, Qayyum, Yeh et al.: "Liver fat: effect of hepatic iron deposition on evaluation with opposed-phase MR imaging." in: Radiology, Vol. 242, Issue 2, pp. 450-5, 2007 (PubMed).

Background publications Lee, Lee, Hahn et al.: "PIAS1 interacts with the KRAB zinc finger protein, ZNF133, via zinc finger motifs and regulates its transcriptional activity." in: Experimental & molecular medicine, Vol. 39, Issue 4, pp. 450-7, 2007 (PubMed).

Validation Images
back to top