Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501766

Chromosome 16 Open Reading Frame 80 (C16orf80) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GTL3, EVORF, fSAP23, C16orf80, C20H16orf80
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Fruit Fly (Drosophila melanogaster), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501766
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C16orf80 antibody: synthetic peptide directed towards the middle region of human C16orf80
Sequence AYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFK LYLPVQNKAK
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against C16orf80. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C16orf80
Background The specific function of C16orf80 is not yet known.
Molecular Weight 23kDa
Gene ID 29105
NCBI Accession NP_037374, NM_013242
UniProt Q9Y6A4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C16orf80 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Jin, Smith, Stark et al.: "Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization." in: Current biology : CB, Vol. 14, Issue 16, pp. 1436-50, 2004 (PubMed).

Alternatives for antigen "Chromosome 16 Open Reading Frame 80 (C16orf80)", type "Antibodies"
Hosts (7), (1)
Reactivities (8), (4), (3), (3), (3), (3), (3), (3)
Applications (8), (2), (1), (1), (1)
Epitopes (3), (2), (1)
Beacon