Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501774

Squamous Cell Carcinoma Antigen Recognized By T Cells 3 (SART3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DSAP1, P100, RP11-13G14, TIP110, p110, p110(nrb), AU045857, mKIAA0156, si:ch211-191d15.4, wu:fc51h03, SART3, DKFZp469J2418
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501774
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SART3 antibody: synthetic peptide directed towards the middle region of human SART3
Sequence LSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMS NADFAKLFLR
Predicted Reactivity Dog : 100%, Human : 100%, Pig : 100%, Rat : 100%, Bovine : 92%, Horse : 92%, Rabbit : 92%, Mouse : 86%, Guinea pig : 76%
Characteristics This is a rabbit polyclonal antibody against SART3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SART3
Background SART3 is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunother
Molecular Weight 110kDa
Gene ID 9733
NCBI Accession NP_055521, NM_014706
UniProt Q15020
Research Area Cancer, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SART3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Squamous Cell Carcinoma Antigen Recognized By T Cells 3 (SART3)", type "Antibodies"
Hosts (23), (5), (1)
Reactivities (28), (15), (15), (13), (13), (12), (1)
Applications (19), (10), (9), (5), (4), (3), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (1), (1)
Beacon