Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 302 (ZNF302) (N-Term) antibody

Details for Product No. ABIN501802
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSD16, MST154, MSTP154, ZNF135L, ZNF140L, ZNF327
Epitope
N-Term
(7), (7), (2), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Fruit Fly (Drosophila melanogaster), Dog (Canine), Human
(17), (2), (2), (2), (2), (1)
Host
Rabbit
(15), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (6), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN501802
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF302
Sequence MSQVTFSDVAIDFSHEEWACLDSAQRDLYKDVMVQNYENL VSVGLSVTKP
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF302. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF302
Background ZNF302 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF302 may be involved in transcriptional regulation.
Molecular Weight 46 kDa
Gene ID 55900
NCBI Accession NM_018443, NP_060913
UniProt Q9NR11-2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 399 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501802
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top