Did you know that you can buy products from over 140 different suppliers from us?

PR Domain Containing 8 (PRDM8) (N-Term) antibody

Details for Product No. ABIN501811
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PRDM8, PFM5, prdm8a, wu:fd12b11, zgc:63680, 4930565F05Rik
Epitope
N-Term
(13), (8), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(18), (2), (2), (2), (1), (1), (1)
Host
Rabbit
(18)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(17), (8), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501811
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PRDM8
Sequence MEDTGIQRGIWDGDAKAVQQCLTDIFTSVYTTCDIPENAI FGPCVLSHTS
Predicted Reactivity Human : 100 %, Dog : 90 %, Guinea pig : 90 %, Mouse : 90 %, Pig : 90 %, Bovine : 80 %, Rabbit : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against PRDM8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PRDM8
Background PRDM8 may be involved in transcriptional regulation.
Molecular Weight 72 kDa
Gene ID 56978
NCBI Accession NM_020226, NP_064611
UniProt Q9NQV8
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 689 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PR Domain Containing 8 (PRDM8) (N-Term) antibody WB Suggested Anti-PRDM8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate
Background publications Xiao, Wilson, Gamblin: "SET domains and histone methylation." in: Current opinion in structural biology, Vol. 13, Issue 6, pp. 699-705, 2003 (PubMed).

Validation Images
back to top