Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501811

PR Domain Containing 8 (PRDM8) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PFM5, 4930565F05Rik, prdm8a, zgc:63680, wu:fd12b11, PRDM8
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501811
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PRDM8 antibody: synthetic peptide directed towards the N terminal of human PRDM8
Sequence MEDTGIQRGIWDGDAKAVQQCLTDIFTSVYTTCDIPENAI FGPCVLSHTS
Predicted Reactivity Human : 100%, Dog : 92%, Guinea pig : 92%, Mouse : 92%, Pig : 92%, Bovine : 85%, Rabbit : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against PRDM8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PRDM8
Background PRDM8 may be involved in transcriptional regulation.
Molecular Weight 72kDa
Gene ID 56978
NCBI Accession NP_064611, NM_020226
UniProt Q9NQV8
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PRDM8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Xiao, Wilson, Gamblin: "SET domains and histone methylation." in: Current opinion in structural biology, Vol. 13, Issue 6, pp. 699-705, 2003 (PubMed).

Alternatives for antigen "PR Domain Containing 8 (PRDM8)", type "Antibodies"
Hosts (14), (1)
Reactivities (15), (2), (2), (2), (1), (1), (1)
Applications (11), (5), (1)
Epitopes (7), (2), (2), (1), (1)
Beacon