Forkhead Box M1 (FOXM1) (Middle Region) antibody

Details for Product No. ABIN501829
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MPP2, TGT3, HFH11, HNF-3, INS-1, MPP-2, PIG29, FKHL16, FOXM1B, HFH-11, TRIDENT, MPHOSPH2, AA408308, AW554517, BB238854, Fkh16, Foxm1b, HFH-11B, Mpm2, WIN, Trident, fkhl16, foxm1l, hfh-11, mpp2, FOXM1
Epitope
Middle Region
(5), (5), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(53), (18), (18), (14)
Host
Rabbit
(34), (19)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(40), (18), (10), (6), (6), (4), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN501829
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FOXM1
Sequence ANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGPDNI NWSQFIPELQ
Predicted Reactivity Human : 100 %, Guinea pig : 90 %, Mouse : 90 %, Rabbit : 90 %, Rat : 90 %, Dog : 70 %
Characteristics This is a rabbit polyclonal antibody against FOXM1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FOXM1
Background This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.
Molecular Weight 84 kDa
Gene ID 2305
NCBI Accession NM_021953, NP_068772
UniProt Q08050
Research Area Cancer, Transcription Factors, Cell Cycle, Kinases/Phosphatases
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 763 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Laoukili, Alvarez, Meijer et al.: "Activation of FoxM1 during G2 requires cyclin A/Cdk-dependent relief of autorepression by the FoxM1 N-terminal domain." in: Molecular and cellular biology, Vol. 28, Issue 9, pp. 3076-87, 2008 (PubMed).

Hosts (34), (19)
Reactivities (53), (18), (18), (14)
Applications (40), (18), (10), (6), (6), (4), (3), (2), (1)
Conjugates (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (5), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top