Tripartite Motif Containing 14 (TRIM14) (Middle Region) antibody

Details for Product No. ABIN501869
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms pub, 5830400N10Rik, TRIM14
Epitope
Middle Region
(4), (3), (3), (2)
Reactivity
Human
(15), (2), (2)
Host
Rabbit
(13), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN501869
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TRIM14
Sequence LSFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALK VSSPRLVSNR
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against TRIM14. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRIM14
Background TRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been de
Molecular Weight 28 kDa
Gene ID 9830
NCBI Accession NM_033221, NP_150090
UniProt Q14142-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 253 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 14 (TRIM14) (Middle Region) antibody WB Suggested Anti-TRIM14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: THP-1 cell lysate
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9...." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Hosts (13), (2)
Reactivities (15), (2), (2)
Applications (15), (3), (2), (2), (2), (1)
Epitopes (4), (3), (3), (2)
back to top