Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501916

Zinc Finger and BTB Domain Containing 12 (ZBTB12) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Ng35, Bat9, C6orf46, D6S59E, G10, NG35, BC020447, Bat-9, bat9, d6s59e, ng35
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN501916
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZBTB12 antibody: synthetic peptide directed towards the N terminal of human ZBTB12
Sequence MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVAD SLKFRGHKVI
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Mouse : 100%, Pig : 100%, African clawed frog : 92%
Characteristics This is a rabbit polyclonal antibody against ZBTB12. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZBTB12
Background ZBTB12 may be involved in transcriptional regulation.
Molecular Weight 49kDa
Gene ID 221527
NCBI Accession NP_862825, NM_181842
UniProt Q9Y330
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZBTB12 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Xie, Rowen, Aguado et al.: "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse." in: Genome research, Vol. 13, Issue 12, pp. 2621-36, 2003 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 12 (ZBTB12)", type "Antibodies"
Hosts (6), (2)
Reactivities (8), (1)
Applications (8), (2), (2)
Epitopes (3), (2), (2), (1), (1), (1)
Beacon