Zinc Finger and BTB Domain Containing 12 (ZBTB12) (N-Term) antibody

Details for Product No. ABIN501916
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Ng35, Bat9, C6orf46, D6S59E, G10, NG35, BC020447, Bat-9, bat9, d6s59e, ng35
Epitope
N-Term
(7), (6), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Xenopus laevis, Human
(12), (1)
Host
Rabbit
(10), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (6), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN501916
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZBTB12
Sequence MASGVEVLRFQLPGHEAATLRNMNQLRAEERFCDVTIVAD SLKFRGHKVI
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Mouse : 100 %, Pig : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against ZBTB12. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZBTB12
Background ZBTB12 may be involved in transcriptional regulation.
Molecular Weight 49 kDa
Gene ID 221527
NCBI Accession NM_181842, NP_862825
UniProt Q9Y330
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 459 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger and BTB Domain Containing 12 (ZBTB12) (N-Term) antibody WB Suggested Anti-ZBTB12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate
Background publications Xie, Rowen, Aguado et al.: "Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse." in: Genome research, Vol. 13, Issue 12, pp. 2621-36, 2003 (PubMed).

Hosts (10), (2)
Reactivities (12), (1)
Applications (12), (6), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (7), (6), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top